Name: GLP-2 TZ
Brand: Lumen Peptides
SKU: GLP-2-TZ
Availability: InStock

Question 1

What is GLP-2 TZ used for in research?

Accepted Answer

GLP-2 TZ is studied in metabolic and incretin-signaling research as a dual GIP/GLP-1 receptor agonist. It is a common reference compound in preclinical models of glucose regulation and energy balance. It is supplied strictly for in-vitro laboratory research - not for human or veterinary use.

Question 2

How does GLP-2 TZ differ from GLP-1 S and GLP-3 RT?

Accepted Answer

GLP-1 S is a single GLP-1 receptor agonist; GLP-2 TZ is a dual GIP + GLP-1 agonist; GLP-3 RT adds a third arm (glucagon receptor). Researchers select among them to study single-, dual-, and triple-incretin receptor engagement. See the on-page class-comparison table for a side-by-side.

Question 3

What is the molecular weight and formula of GLP-2 TZ?

Accepted Answer

GLP-2 TZ has the molecular formula C225H348N48O68 and a molecular weight of approximately 4813.5 g/mol (CAS 2023788-19-2). These reference values, along with the tested lot purity, appear in the molecular-structure section and on each Certificate of Analysis.

Question 4

Is GLP-2 TZ for human use?

Accepted Answer

No. GLP-2 TZ is sold strictly for in-vitro laboratory research and development (Research Use Only). It is not a drug, supplement, food or cosmetic, and is not intended to diagnose, treat, cure or prevent any disease, nor for human or veterinary use.

Question 5

What purity is GLP-2 TZ tested to?

Accepted Answer

GLP-2 TZ is documented at 99.6% by RP-HPLC, with identity confirmed against a reference standard. Every lot ships with an independent third-party Certificate of Analysis you can look up by lot number before purchase.

Question 6

Does GLP-2 TZ come with a Certificate of Analysis?

Accepted Answer

Yes. Each lot of GLP-2 TZ is third-party tested and its COA - purity, identity, content and appearance - is published in our COA library and resolvable on the Verify page.

Question 7

What sizes of GLP-2 TZ are available?

Accepted Answer

GLP-2 TZ is available in 10mg, 30mg, 60mg, 100mg. Larger sizes carry a lower per-milligram cost - see the size selector for exact pricing and value. Retail orders include a standing Buy-1-Get-1 offer; wholesale pricing is available above the $500 order minimum.

Question 8

How should GLP-2 TZ be stored and reconstituted?

Accepted Answer

Lyophilized GLP-2 TZ is best kept at −20°C for long-term storage and is stable at ambient temperature for transit. Reconstitute with bacteriostatic water; store the reconstituted solution at 2-8°C and use within about 2-4 weeks. See our Storage & Reconstitution guide for full handling.

Question 9

What is the amino-acid sequence of GLP-2 TZ?

Accepted Answer

The reference sequence is YXEGTFTSDYSIYLDKKIAQKAFVQWLIAGGPSSGAPPPS. Molecular formula and weight are shown in the molecular-structure section; where a value is compound-specific it is listed as "See COA".

Question 10

How do I verify my GLP-2 TZ lot is authentic?

Accepted Answer

Enter the lot number printed on your vial on the Verify page. It resolves the exact third-party report for that lot, so you can confirm the HPLC purity and identity before use.

GLP-2 TZ

How it is studied